PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g008150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 199aa    MW: 22490 Da    PI: 5.43
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g008150.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.21.2e-24959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k+ie +snr vtfskRr+ ++KKA+EL +LCd++v vi++s++gklyey++
  Sopen04g008150.1  9 KKIEKTSNRLVTFSKRRQSLIKKANELAILCDVDVGVIVYSQSGKLYEYAK 59
                      68***********************************************85 PP

2K-box36.42.1e-13821561286
             K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                       ++ e+ q+el++Lk+ei  L r q  ll ++L+ Ls+ eLqqLe+ L+++   i+++ ++ l+ q e     e++
  Sopen04g008150.1  82 TTKEEPQTELDNLKEEIAVLHRMQSGLLAKKLDGLSFTELQQLEHLLKEGALCIKDHMERKLMGQFESYMPEEEA 156
                       556889*******************************************************99999977665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.9E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.104161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.22E-28282IPR002100Transcription factor, MADS-box
CDDcd002651.92E-35274No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-24323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-243859IPR002100Transcription factor, MADS-box
PfamPF014863.8E-983157IPR002487Transcription factor, K-box
PROSITE profilePS512978.55684173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MGRGKVELKK IEKTSNRLVT FSKRRQSLIK KANELAILCD VDVGVIVYSQ SGKLYEYAKP  60
SMGNILARYN PNSEPAIVET VTTKEEPQTE LDNLKEEIAV LHRMQSGLLA KKLDGLSFTE  120
LQQLEHLLKE GALCIKDHME RKLMGQFESY MPEEEAMIEA TILPEQVAMK ENFLDEADTS  180
LHLRLSVDTN LKLGPPKSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-17175175Myocyte-specific enhancer factor 2B
1tqe_R1e-17175175Myocyte-specific enhancer factor 2B
1tqe_Q1e-17175175Myocyte-specific enhancer factor 2B
1tqe_P1e-17175175Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-96HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072422.11e-145PREDICTED: MADS-box transcription factor 23-like
TrEMBLK4BQA81e-92K4BQA8_SOLLC; Uncharacterized protein
STRINGSolyc04g016070.2.14e-92(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.11e-37AGAMOUS-like 15